Lineage for d2mucb2 (2muc B:4-130)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947583Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2947792Protein Muconate-lactonizing enzyme (cis muconate cycloisomerase) [54836] (1 species)
  7. 2947793Species Pseudomonas putida [TaxId:303] [54837] (5 PDB entries)
  8. 2947798Domain d2mucb2: 2muc B:4-130 [38886]
    Other proteins in same PDB: d2muca1, d2mucb1
    complexed with mn

Details for d2mucb2

PDB Entry: 2muc (more details), 2.3 Å

PDB Description: muconate cycloisomerase variant f329i
PDB Compounds: (B:) protein (muconate cycloisomerase)

SCOPe Domain Sequences for d2mucb2:

Sequence, based on SEQRES records: (download)

>d2mucb2 d.54.1.1 (B:4-130) Muconate-lactonizing enzyme (cis muconate cycloisomerase) {Pseudomonas putida [TaxId: 303]}
alieridaiivdlptirphklamhtmqqqtlvvlrvrcsdgvegigeattigglaygyes
pegikanidahlapaliglaadninaamlkldklakgntfaksgiesalldaqgkrlglp
vsellgg

Sequence, based on observed residues (ATOM records): (download)

>d2mucb2 d.54.1.1 (B:4-130) Muconate-lactonizing enzyme (cis muconate cycloisomerase) {Pseudomonas putida [TaxId: 303]}
alieridaiivdlptirqqqtlvvlrvrcsdgvegigeattigglaygyespegikanid
ahlapaliglaadninaamlkldklakgntfaksgiesalldaqgkrlglpvsellgg

SCOPe Domain Coordinates for d2mucb2:

Click to download the PDB-style file with coordinates for d2mucb2.
(The format of our PDB-style files is described here.)

Timeline for d2mucb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mucb1