Lineage for d7brta1 (7brt A:3-134)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502275Family d.15.1.3: GABARAP-like [54253] (4 proteins)
    intracellular membrane trafficking and fusion proteins
    automatically mapped to Pfam PF02991
  6. 2502276Protein GABA(A) receptor associated protein GABARAP [69658] (3 species)
  7. 2502277Species Human (Homo sapiens) [TaxId:9606] [69659] (8 PDB entries)
  8. 3088782Domain d7brta1: 7brt A:3-134 [388844]
    Other proteins in same PDB: d7brta2, d7brtb2
    automated match to d1gnua_

Details for d7brta1

PDB Entry: 7brt (more details), 2 Å

PDB Description: crystal structure of sec62 lir fused to gabarap
PDB Compounds: (A:) Translocation protein SEC62,Gamma-aminobutyric acid receptor-associated protein

SCOPe Domain Sequences for d7brta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7brta1 d.15.1.3 (A:3-134) GABA(A) receptor associated protein GABARAP {Human (Homo sapiens) [TaxId: 9606]}
ndfemidkeeleqqtdmkstykeehpfekrrsegekirkkypdrvpvivekapkarigdl
dkkkylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedff
lyiaysdesvyg

SCOPe Domain Coordinates for d7brta1:

Click to download the PDB-style file with coordinates for d7brta1.
(The format of our PDB-style files is described here.)

Timeline for d7brta1:

  • d7brta1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d7brta2