![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) ![]() |
![]() | Family d.54.1.1: Enolase N-terminal domain-like [54827] (10 proteins) C-terminal domain is beta/alpha-barrel |
![]() | Protein D-glucarate dehydratase [54831] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [54833] (6 PDB entries) |
![]() | Domain d1ecqd2: 1ecq D:5-137 [38877] Other proteins in same PDB: d1ecqa1, d1ecqb1, d1ecqc1, d1ecqd1 |
PDB Entry: 1ecq (more details), 2 Å
SCOP Domain Sequences for d1ecqd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ecqd2 d.54.1.1 (D:5-137) D-glucarate dehydratase {Escherichia coli} fttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirkt ledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldll gqhlgvnvasllg
Timeline for d1ecqd2: