Lineage for d1ecqd2 (1ecq D:5-137)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411574Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 411575Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 411576Family d.54.1.1: Enolase N-terminal domain-like [54827] (9 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 411595Protein D-glucarate dehydratase [54831] (2 species)
  7. 411596Species Escherichia coli [TaxId:562] [54833] (6 PDB entries)
  8. 411616Domain d1ecqd2: 1ecq D:5-137 [38877]
    Other proteins in same PDB: d1ecqa1, d1ecqb1, d1ecqc1, d1ecqd1
    complexed with dxg, ipa, mg

Details for d1ecqd2

PDB Entry: 1ecq (more details), 2 Å

PDB Description: e. coli glucarate dehydratase bound to 4-deoxyglucarate

SCOP Domain Sequences for d1ecqd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ecqd2 d.54.1.1 (D:5-137) D-glucarate dehydratase {Escherichia coli}
fttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirkt
ledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldll
gqhlgvnvasllg

SCOP Domain Coordinates for d1ecqd2:

Click to download the PDB-style file with coordinates for d1ecqd2.
(The format of our PDB-style files is described here.)

Timeline for d1ecqd2: