SCOP 1.69: Domain d1ecqc2: 1ecq C:4-137

Lineage for d1ecqc2 (1ecq C:4-137)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (10 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein D-glucarate dehydratase [54831] (2 species)

7. Species Escherichia coli [TaxId:562] [54833] (6 PDB entries)

8. Domain d1ecqc2: 1ecq C:4-137 [38876]
   Other proteins in same PDB: d1ecqa1, d1ecqb1, d1ecqc1, d1ecqd1

Details for d1ecqc2

PDB Entry: 1ecq, 2 Å

PDB Description: e. coli glucarate dehydratase bound to 4-deoxyglucarate

SCOP Domain Sequences for d1ecqc2:

Sequence; same for both SEQRES and ATOM records:

>d1ecqc2 d.54.1.1 (C:4-137) D-glucarate dehydratase {Escherichia coli}
qfttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirk
tledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldl
lgqhlgvnvasllg

Timeline for d1ecqc2:

• d1ecqc2 first appeared (with stable ids) in SCOP 1.55
  
• d1ecqc2 appears in SCOP 1.67
  
• d1ecqc2 appears in SCOP 1.71
  
• d1ecqc2 appears in the current release, SCOPe 2.08