Lineage for d1ecqc2 (1ecq C:4-137)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32233Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
  4. 32234Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 32235Family d.54.1.1: Enolase N-terminal domain-like [54827] (6 proteins)
  6. 32241Protein D-glucarate dehydratase [54831] (2 species)
  7. 32242Species Escherichia coli [TaxId:562] [54833] (4 PDB entries)
  8. 32257Domain d1ecqc2: 1ecq C:4-137 [38876]
    Other proteins in same PDB: d1ecqa1, d1ecqb1, d1ecqc1, d1ecqd1

Details for d1ecqc2

PDB Entry: 1ecq (more details), 2 Å

PDB Description: e. coli glucarate dehydratase bound to 4-deoxyglucarate

SCOP Domain Sequences for d1ecqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ecqc2 d.54.1.1 (C:4-137) D-glucarate dehydratase {Escherichia coli}
qfttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirk
tledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldl
lgqhlgvnvasllg

SCOP Domain Coordinates for d1ecqc2:

Click to download the PDB-style file with coordinates for d1ecqc2.
(The format of our PDB-style files is described here.)

Timeline for d1ecqc2: