![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) ![]() |
![]() | Family d.54.1.1: Enolase N-terminal domain-like [54827] (10 proteins) C-terminal domain is beta/alpha-barrel |
![]() | Protein D-glucarate dehydratase [54831] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [54833] (6 PDB entries) |
![]() | Domain d1ec9c2: 1ec9 C:4-137 [38872] Other proteins in same PDB: d1ec9a1, d1ec9b1, d1ec9c1, d1ec9d1 |
PDB Entry: 1ec9 (more details), 2 Å
SCOP Domain Sequences for d1ec9c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ec9c2 d.54.1.1 (C:4-137) D-glucarate dehydratase {Escherichia coli} qfttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirk tledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldl lgqhlgvnvasllg
Timeline for d1ec9c2: