Lineage for d6vmzc1 (6vmz C:11-331)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776270Species Influenza a virus (a/chicken/vietnam/4/2003(h5n1)) [TaxId:380835] [376835] (4 PDB entries)
  8. 2776274Domain d6vmzc1: 6vmz C:11-331 [388694]
    Other proteins in same PDB: d6vmza2, d6vmzb_, d6vmzc2, d6vmzd_, d6vmze2
    automated match to d3ztna_
    complexed with nag, r3p

Details for d6vmzc1

PDB Entry: 6vmz (more details), 2.2 Å

PDB Description: crystal structure of a h5n1 influenza virus hemagglutinin with cbs1117
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d6vmzc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vmzc1 b.19.1.0 (C:11-331) automated matches {Influenza a virus (a/chicken/vietnam/4/2003(h5n1)) [TaxId: 380835]}
dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d6vmzc1:

Click to download the PDB-style file with coordinates for d6vmzc1.
(The format of our PDB-style files is described here.)

Timeline for d6vmzc1: