Lineage for d1pdz_2 (1pdz 1-139)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328547Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 328548Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 328549Family d.54.1.1: Enolase N-terminal domain-like [54827] (8 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 328592Protein Enolase [54828] (5 species)
  7. 328621Species Lobster (Homarus vulgaris) [54830] (2 PDB entries)
  8. 328622Domain d1pdz_2: 1pdz 1-139 [38859]
    Other proteins in same PDB: d1pdz_1
    complexed with mn, pga

Details for d1pdz_2

PDB Entry: 1pdz (more details), 2.2 Å

PDB Description: x-ray structure and catalytic mechanism of lobster enolase
PDB Compounds: ( :)

SCOP Domain Sequences for d1pdz_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pdz_2 d.54.1.1 (1-139) Enolase {Lobster (Homarus vulgaris)}
sitkvfartifdsrgnptvevdlytskglfraavpsgastgvhealemrdgdkskyhgks
vfnavknvndvivpeiiksglkvtqqkecdefmckldgtenksslganailgvslaicka
gaaelgiplyrhianlany

SCOP Domain Coordinates for d1pdz_2:

Click to download the PDB-style file with coordinates for d1pdz_2.
(The format of our PDB-style files is described here.)

Timeline for d1pdz_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pdz_1