![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) ![]() |
![]() | Family d.54.1.1: Enolase N-terminal domain-like [54827] (9 proteins) C-terminal domain is beta/alpha-barrel |
![]() | Protein Enolase [54828] (5 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (14 PDB entries) |
![]() | Domain d1nel_2: 1nel 1-141 [38858] Other proteins in same PDB: d1nel_1 complexed with f f, mg, po4 |
PDB Entry: 1nel (more details), 2.6 Å
SCOP Domain Sequences for d1nel_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nel_2 d.54.1.1 (1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae)} avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg vlhavknvndviapafvkanidvsdqkavddflisldgtanksklganailgvslaasra aaaeknvplykhladlskskt
Timeline for d1nel_2: