Lineage for d1nel_2 (1nel 1-141)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) 
Family d.54.1.1: Enolase N-terminal domain-like [54827] (6 proteins) 
Protein Enolase [54828] (2 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (11 PDB entries) 
Domain d1nel_2: 1nel 1-141 [38858]
Other proteins in same PDB: d1nel_1
Details for d1nel_2
PDB Entry: 1nel (more details), 2.6 Å
PDB Description: fluoride inhibition of yeast enolase: crystal structure of the enolase-mg2+-f--pi complex at 2.6-angstroms resolution
SCOP Domain Sequences for d1nel_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nel_2 d.54.1.1 (1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae)}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvsdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt
SCOP Domain Coordinates for d1nel_2:
Click to download the PDB-style file with coordinates for d1nel_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nel_2:
- d1nel_2 appears in SCOP 1.57
- d1nel_2 appears in the current release, SCOPe 2.08, called d1nela2
View in 3D
