Lineage for d1els_2 (1els 1-141)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 256875Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 256876Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 256877Family d.54.1.1: Enolase N-terminal domain-like [54827] (8 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 256920Protein Enolase [54828] (3 species)
  7. 256921Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (12 PDB entries)
  8. 256939Domain d1els_2: 1els 1-141 [38857]
    Other proteins in same PDB: d1els_1
    complexed with mn, pah

Details for d1els_2

PDB Entry: 1els (more details), 2.4 Å

PDB Description: catalytic metal ion binding in enolase: the crystal structure of enolase-mn2+-phosphonoacetohydroxamate complex at 2.4 angstroms resolution
PDB Compounds: ( :)

SCOP Domain Sequences for d1els_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1els_2 d.54.1.1 (1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae)}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvsdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt

SCOP Domain Coordinates for d1els_2:

Click to download the PDB-style file with coordinates for d1els_2.
(The format of our PDB-style files is described here.)

Timeline for d1els_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1els_1