SCOP 1.67: Domain d3enl_2: 3enl 1-141

Lineage for d3enl_2 (3enl 1-141)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (9 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein Enolase [54828] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (14 PDB entries)

8. Domain d3enl_2: 3enl 1-141 [38855]
   Other proteins in same PDB: d3enl_1
   complexed with so4

Details for d3enl_2

PDB Entry: 3enl, 2.25 Å

PDB Description: refined structure of yeast apo-enolase at 2.25 angstroms resolution

SCOP Domain Sequences for d3enl_2:

Sequence; same for both SEQRES and ATOM records:

>d3enl_2 d.54.1.1 (1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae)}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvsdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt

Timeline for d3enl_2:

• d3enl_2 first appeared (with stable ids) in SCOP 1.55
  
• d3enl_2 appears in SCOP 1.65
  
• d3enl_2 appears in SCOP 1.69
  
• d3enl_2 appears in the current release, SCOPe 2.08, called d3enla2