SCOP 1.55: Domain d1ebgb2: 1ebg B:1-141

Lineage for d1ebgb2 (1ebg B:1-141)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (6 proteins)

6. Protein Enolase [54828] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (11 PDB entries)

8. Domain d1ebgb2: 1ebg B:1-141 [38854]
   Other proteins in same PDB: d1ebga1, d1ebgb1

Details for d1ebgb2

PDB Entry: 1ebg, 2.1 Å

PDB Description: chelation of ser 39 to mg2+ latches a gate at the active site of enolase: structure of the bis(mg2+) complex of yeast enolase and the intermediate analog phosphonoacetohydroxamate at 2.1 angstroms resolution

SCOP Domain Sequences for d1ebgb2:

Sequence; same for both SEQRES and ATOM records:

>d1ebgb2 d.54.1.1 (B:1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae)}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt

Timeline for d1ebgb2:

• d1ebgb2 appears in SCOP 1.57
  
• d1ebgb2 appears in the current release, SCOPe 2.08