Lineage for d6enl_2 (6enl 1-141)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328547Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 328548Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 328549Family d.54.1.1: Enolase N-terminal domain-like [54827] (8 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 328592Protein Enolase [54828] (5 species)
  7. 328593Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (12 PDB entries)
  8. 328602Domain d6enl_2: 6enl 1-141 [38852]
    Other proteins in same PDB: d6enl_1
    complexed with 2pl, zn

Details for d6enl_2

PDB Entry: 6enl (more details), 2.2 Å

PDB Description: inhibition of enolase: the crystal structures of enolase-ca2+- phosphoglycerate and enolase-zn2+-phosphoglycolate complexes at 2.2- angstroms resolution
PDB Compounds: ( :)

SCOP Domain Sequences for d6enl_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6enl_2 d.54.1.1 (1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae)}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvsdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt

SCOP Domain Coordinates for d6enl_2:

Click to download the PDB-style file with coordinates for d6enl_2.
(The format of our PDB-style files is described here.)

Timeline for d6enl_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6enl_1