SCOP 1.55: Domain d1oneb2: 1one B:1-141

Lineage for d1oneb2 (1one B:1-141)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (6 proteins)

6. Protein Enolase [54828] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (11 PDB entries)

8. Domain d1oneb2: 1one B:1-141 [38845]
   Other proteins in same PDB: d1onea1, d1oneb1

Details for d1oneb2

PDB Entry: 1one, 1.8 Å

PDB Description: yeast enolase complexed with an equilibrium mixture of 2'-phosphoglyceate and phosphoenolpyruvate

SCOP Domain Sequences for d1oneb2:

Sequence; same for both SEQRES and ATOM records:

>d1oneb2 d.54.1.1 (B:1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae)}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt

Timeline for d1oneb2:

• d1oneb2 appears in SCOP 1.57
  
• d1oneb2 appears in the current release, SCOPe 2.08