Lineage for d1hnwc2 (1hnw C:107-207)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554405Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 2554406Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
    automatically mapped to Pfam PF00189
  5. 2554407Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 2554408Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)
  7. 2554434Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
    Uniprot P80372
  8. 2554448Domain d1hnwc2: 1hnw C:107-207 [38842]
    Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_
    complexed with mg, tac, zn

Details for d1hnwc2

PDB Entry: 1hnw (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d1hnwc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnwc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOPe Domain Coordinates for d1hnwc2:

Click to download the PDB-style file with coordinates for d1hnwc2.
(The format of our PDB-style files is described here.)

Timeline for d1hnwc2: