| Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
| Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily) alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143 |
Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) ![]() |
| Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein) |
| Protein Ribosomal protein S3 C-terminal domain [54823] (1 species) |
| Species Thermus thermophilus [TaxId:274] [54824] (18 PDB entries) |
| Domain d1hnzc2: 1hnz C:107-207 [38841] Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_ complexed with hyg, mg, zn |
PDB Entry: 1hnz (more details), 3.3 Å
SCOP Domain Sequences for d1hnzc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnzc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev
Timeline for d1hnzc2: