SCOP 1.67: Domain d1hnzc2: 1hnz C:107-207

Lineage for d1hnzc2 (1hnz C:107-207)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
   alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143

4. Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family)

5. Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)

6. Protein Ribosomal protein S3 C-terminal domain [54823] (1 species)

7. Species Thermus thermophilus [TaxId:274] [54824] (14 PDB entries)

8. Domain d1hnzc2: 1hnz C:107-207 [38841]
   Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_
   complexed with hyg, mg, zn

Details for d1hnzc2

PDB Entry: 1hnz, 3.3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b

SCOP Domain Sequences for d1hnzc2:

Sequence; same for both SEQRES and ATOM records:

>d1hnzc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

Timeline for d1hnzc2:

• d1hnzc2 first appeared (with stable ids) in SCOP 1.55
  
• d1hnzc2 appears in SCOP 1.65
  
• d1hnzc2 appears in SCOP 1.69
  
• d1hnzc2 appears in the current release, SCOPe 2.08