Lineage for d1hr0c2 (1hr0 C:107-207)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554405Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 2554406Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
    automatically mapped to Pfam PF00189
  5. 2554407Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 2554408Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)
  7. 2554434Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
    Uniprot P80372
  8. 2554441Domain d1hr0c2: 1hr0 C:107-207 [38840]
    Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_
    complexed with mg, zn

Details for d1hr0c2

PDB Entry: 1hr0 (more details), 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d1hr0c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr0c2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOPe Domain Coordinates for d1hr0c2:

Click to download the PDB-style file with coordinates for d1hr0c2.
(The format of our PDB-style files is described here.)

Timeline for d1hr0c2: