| Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
| Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily) |
Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) ![]() |
| Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein) |
| Protein Ribosomal protein S3 C-terminal domain [54823] (1 species) |
| Species Thermus thermophilus [TaxId:274] [54824] (6 PDB entries) |
| Domain d1hr0c2: 1hr0 C:107-207 [38840] Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_ |
PDB Entry: 1hr0 (more details), 3.2 Å
SCOP Domain Sequences for d1hr0c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hr0c2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev
Timeline for d1hr0c2: