SCOPe 2.04: Domain d1fjgc2: 1fjg C:107-207

Lineage for d1fjgc2 (1fjg C:107-207)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
   alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143

4. Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family)
   automatically mapped to Pfam PF00189

5. Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)

6. Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
   Uniprot P80372

8. Domain d1fjgc2: 1fjg C:107-207 [38839]
   Other proteins in same PDB: d1fjgb_, d1fjgc1, d1fjgd_, d1fjge1, d1fjge2, d1fjgf_, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgm_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_
   complexed with mg, par, scm, sry, zn

Details for d1fjgc2

PDB Entry: 1fjg, 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin

PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d1fjgc2:

Sequence; same for both SEQRES and ATOM records:

>d1fjgc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

Timeline for d1fjgc2:

• d1fjgc2 first appeared (with stable ids) in SCOP 1.55
  
• d1fjgc2 appears in SCOPe 2.03
  
• d1fjgc2 appears in SCOPe 2.05
  
• d1fjgc2 appears in the current release, SCOPe 2.08