Lineage for d1egaa2 (1ega A:183-295)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411467Fold d.52: Alpha-lytic protease prodomain-like [54805] (7 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 411494Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 411495Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 411496Protein GTPase Era C-terminal domain [54818] (1 species)
  7. 411497Species Escherichia coli [TaxId:562] [54819] (1 PDB entry)
  8. 411498Domain d1egaa2: 1ega A:183-295 [38836]
    Other proteins in same PDB: d1egaa1, d1egab1

Details for d1egaa2

PDB Entry: 1ega (more details), 2.4 Å

PDB Description: crystal structure of a widely conserved gtpase era

SCOP Domain Sequences for d1egaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egaa2 d.52.3.1 (A:183-295) GTPase Era C-terminal domain {Escherichia coli}
dyitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilveregq
kkmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrsl

SCOP Domain Coordinates for d1egaa2:

Click to download the PDB-style file with coordinates for d1egaa2.
(The format of our PDB-style files is described here.)

Timeline for d1egaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1egaa1