SCOP 1.65: Domain d1egaa2: 1ega A:183-295

Lineage for d1egaa2 (1ega A:183-295)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (7 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)

6. Protein GTPase Era C-terminal domain [54818] (1 species)

7. Species Escherichia coli [TaxId:562] [54819] (1 PDB entry)

8. Domain d1egaa2: 1ega A:183-295 [38836]
   Other proteins in same PDB: d1egaa1, d1egab1

Details for d1egaa2

PDB Entry: 1ega, 2.4 Å

PDB Description: crystal structure of a widely conserved gtpase era

SCOP Domain Sequences for d1egaa2:

Sequence; same for both SEQRES and ATOM records:

>d1egaa2 d.52.3.1 (A:183-295) GTPase Era C-terminal domain {Escherichia coli}
dyitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilveregq
kkmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrsl

Timeline for d1egaa2:

• d1egaa2 first appeared (with stable ids) in SCOP 1.55
  
• d1egaa2 appears in SCOP 1.63
  
• d1egaa2 appears in SCOP 1.67
  
• d1egaa2 appears in the current release, SCOPe 2.08