Lineage for d1hnwc1 (1hnw C:2-106)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79802Fold d.52: Alpha-lytic protease prodomain-like [54805] (3 superfamilies)
  4. 79829Superfamily d.52.3: Ribosomal protein S3 N-terminal domain-like [54814] (1 family) (S)
  5. 79830Family d.52.3.1: Ribosomal protein S3 N-terminal domain-like [54815] (2 proteins)
  6. 79835Protein Ribosomal protein S3 N-terminal domain [54816] (1 species)
  7. 79836Species Thermus thermophilus [TaxId:274] [54817] (10 PDB entries)
  8. 79842Domain d1hnwc1: 1hnw C:2-106 [38834]
    Other proteins in same PDB: d1hnwb_, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_

Details for d1hnwc1

PDB Entry: 1hnw (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline

SCOP Domain Sequences for d1hnwc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnwc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

SCOP Domain Coordinates for d1hnwc1:

Click to download the PDB-style file with coordinates for d1hnwc1.
(The format of our PDB-style files is described here.)

Timeline for d1hnwc1: