Lineage for d1hnzc1 (1hnz C:2-106)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32181Fold d.52: Alpha-lytic protease prodomain-like [54805] (3 superfamilies)
  4. 32208Superfamily d.52.3: Ribosomal protein S3 N-terminal domain-like [54814] (1 family) (S)
  5. 32209Family d.52.3.1: Ribosomal protein S3 N-terminal domain-like [54815] (2 proteins)
  6. 32214Protein Ribosomal protein S3 N-terminal domain [54816] (1 species)
  7. 32215Species Thermus thermophilus [TaxId:274] [54817] (6 PDB entries)
  8. 32218Domain d1hnzc1: 1hnz C:2-106 [38833]
    Other proteins in same PDB: d1hnzb_, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_

Details for d1hnzc1

PDB Entry: 1hnz (more details), 3.3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b

SCOP Domain Sequences for d1hnzc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnzc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

SCOP Domain Coordinates for d1hnzc1:

Click to download the PDB-style file with coordinates for d1hnzc1.
(The format of our PDB-style files is described here.)

Timeline for d1hnzc1: