Lineage for d1fjgc1 (1fjg C:2-106)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 860188Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 860215Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 860216Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 860229Protein Ribosomal protein S3 N-terminal domain [54816] (4 species)
  7. 860259Species Thermus thermophilus [TaxId:274] [54817] (36 PDB entries)
    Uniprot P80372
  8. 860261Domain d1fjgc1: 1fjg C:2-106 [38831]
    Other proteins in same PDB: d1fjgb_, d1fjgc2, d1fjgd_, d1fjge1, d1fjge2, d1fjgf_, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgm_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_
    complexed with mg, par, scm, sry, zn

Details for d1fjgc1

PDB Entry: 1fjg (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
PDB Compounds: (C:) 30S ribosomal protein S3

SCOP Domain Sequences for d1fjgc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjgc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

SCOP Domain Coordinates for d1fjgc1:

Click to download the PDB-style file with coordinates for d1fjgc1.
(The format of our PDB-style files is described here.)

Timeline for d1fjgc1: