Lineage for d1fjgc1 (1fjg C:2-106)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32181Fold d.52: Alpha-lytic protease prodomain-like [54805] (3 superfamilies)
  4. 32208Superfamily d.52.3: Ribosomal protein S3 N-terminal domain-like [54814] (1 family) (S)
  5. 32209Family d.52.3.1: Ribosomal protein S3 N-terminal domain-like [54815] (2 proteins)
  6. 32214Protein Ribosomal protein S3 N-terminal domain [54816] (1 species)
  7. 32215Species Thermus thermophilus [TaxId:274] [54817] (6 PDB entries)
  8. 32217Domain d1fjgc1: 1fjg C:2-106 [38831]
    Other proteins in same PDB: d1fjgb_, d1fjgc2, d1fjgd_, d1fjge1, d1fjge2, d1fjgf_, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgm_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_

Details for d1fjgc1

PDB Entry: 1fjg (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin

SCOP Domain Sequences for d1fjgc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjgc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

SCOP Domain Coordinates for d1fjgc1:

Click to download the PDB-style file with coordinates for d1fjgc1.
(The format of our PDB-style files is described here.)

Timeline for d1fjgc1: