Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (3 superfamilies) |
Superfamily d.52.3: Ribosomal protein S3 N-terminal domain-like [54814] (1 family) |
Family d.52.3.1: Ribosomal protein S3 N-terminal domain-like [54815] (2 proteins) |
Protein Ribosomal protein S3 N-terminal domain [54816] (1 species) |
Species Thermus thermophilus [TaxId:274] [54817] (10 PDB entries) |
Domain d1fjfc1: 1fjf C:2-106 [38830] Other proteins in same PDB: d1fjfb_, d1fjfc2, d1fjfd_, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfj_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_ |
PDB Entry: 1fjf (more details), 3.05 Å
SCOP Domain Sequences for d1fjfc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fjfc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus} gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev
Timeline for d1fjfc1: