SCOP 1.57: Domain d1fjfc1: 1fjf C:2-106

Lineage for d1fjfc1 (1fjf C:2-106)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (3 superfamilies)

4. Superfamily d.52.3: Ribosomal protein S3 N-terminal domain-like [54814] (1 family)

5. Family d.52.3.1: Ribosomal protein S3 N-terminal domain-like [54815] (2 proteins)

6. Protein Ribosomal protein S3 N-terminal domain [54816] (1 species)

7. Species Thermus thermophilus [TaxId:274] [54817] (10 PDB entries)

8. Domain d1fjfc1: 1fjf C:2-106 [38830]
   Other proteins in same PDB: d1fjfb_, d1fjfc2, d1fjfd_, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfj_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_

Details for d1fjfc1

PDB Entry: 1fjf, 3.05 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit

SCOP Domain Sequences for d1fjfc1:

Sequence; same for both SEQRES and ATOM records:

>d1fjfc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

Timeline for d1fjfc1:

• d1fjfc1 first appeared (with stable ids) in SCOP 1.55
  
• d1fjfc1 last appears in SCOP 1.59