SCOP 1.63: Domain d2proc2: 2pro C:86-158

Lineage for d2proc2 (2pro C:86-158)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (6 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.1: Alpha-lytic protease prodomain [54806] (1 family)

5. Family d.52.1.1: Alpha-lytic protease prodomain [54807] (1 protein)

6. Protein Alpha-lytic protease prodomain [54808] (1 species)
   duplication: consists of two domains of this fold

7. Species Lysobacter enzymogenes [TaxId:69] [54809] (3 PDB entries)

8. Domain d2proc2: 2pro C:86-158 [38825]

Details for d2proc2

PDB Entry: 2pro, 3 Å

PDB Description: pro region of alpha-lytic protease

SCOP Domain Sequences for d2proc2:

Sequence, based on SEQRES records:

>d2proc2 d.52.1.1 (C:86-158) Alpha-lytic protease prodomain {Lysobacter enzymogenes}
yslkqlqsameqldaganarvkgvskpldgvqswyvdprsnavvvkvddgatdagvdfva
lsgadsaqvries

Sequence, based on observed residues (ATOM records):

>d2proc2 d.52.1.1 (C:86-158) Alpha-lytic protease prodomain {Lysobacter enzymogenes}
yslkqlqsameqldagagvqswyvdprsnavvvkvddgatdagvdfvalsgadsaqvrie
s

Timeline for d2proc2:

• d2proc2 first appeared (with stable ids) in SCOP 1.55
  
• d2proc2 appears in SCOP 1.61
  
• d2proc2 appears in SCOP 1.65
  
• d2proc2 appears in the current release, SCOPe 2.08