SCOP 1.55: Domain d2proc1: 2pro C:18-85

Lineage for d2proc1 (2pro C:18-85)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (3 superfamilies)

4. Superfamily d.52.1: Alpha-lytic protease prodomain [54806] (1 family)

5. Family d.52.1.1: Alpha-lytic protease prodomain [54807] (1 protein)

6. Protein Alpha-lytic protease prodomain [54808] (1 species)

7. Species Lysobacter enzymogenes [TaxId:69] [54809] (3 PDB entries)

8. Domain d2proc1: 2pro C:18-85 [38824]

Details for d2proc1

PDB Entry: 2pro, 3 Å

PDB Description: pro region of alpha-lytic protease

SCOP Domain Sequences for d2proc1:

Sequence; same for both SEQRES and ATOM records:

>d2proc1 d.52.1.1 (C:18-85) Alpha-lytic protease prodomain {Lysobacter enzymogenes}
ifptqlpqylqteklartqaaaierefgaqfagswiernedgsfklvaatsgarksstlg
gvevrnvr

Timeline for d2proc1:

• d2proc1 appears in SCOP 1.57
  
• d2proc1 appears in the current release, SCOPe 2.08