Lineage for d2prob2 (2pro B:86-158)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602714Fold d.52: Alpha-lytic protease prodomain-like [54805] (8 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 602715Superfamily d.52.1: Alpha-lytic protease prodomain [54806] (1 family) (S)
  5. 602716Family d.52.1.1: Alpha-lytic protease prodomain [54807] (1 protein)
  6. 602717Protein Alpha-lytic protease prodomain [54808] (1 species)
    duplication: consists of two domains of this fold
  7. 602718Species Lysobacter enzymogenes [TaxId:69] [54809] (3 PDB entries)
  8. 602730Domain d2prob2: 2pro B:86-158 [38823]

Details for d2prob2

PDB Entry: 2pro (more details), 3 Å

PDB Description: pro region of alpha-lytic protease

SCOP Domain Sequences for d2prob2:

Sequence, based on SEQRES records: (download)

>d2prob2 d.52.1.1 (B:86-158) Alpha-lytic protease prodomain {Lysobacter enzymogenes}
yslkqlqsameqldaganarvkgvskpldgvqswyvdprsnavvvkvddgatdagvdfva
lsgadsaqvries

Sequence, based on observed residues (ATOM records): (download)

>d2prob2 d.52.1.1 (B:86-158) Alpha-lytic protease prodomain {Lysobacter enzymogenes}
yslkqlqsameqldagagvqswyvdprsnavvvkvddgatdagvdfvalsgadsaqvrie
s

SCOP Domain Coordinates for d2prob2:

Click to download the PDB-style file with coordinates for d2prob2.
(The format of our PDB-style files is described here.)

Timeline for d2prob2: