Lineage for d2prob2 (2pro B:86-158)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32181Fold d.52: Alpha-lytic protease prodomain-like [54805] (3 superfamilies)
  4. 32182Superfamily d.52.1: Alpha-lytic protease prodomain [54806] (1 family) (S)
  5. 32183Family d.52.1.1: Alpha-lytic protease prodomain [54807] (1 protein)
  6. 32184Protein Alpha-lytic protease prodomain [54808] (1 species)
  7. 32185Species Lysobacter enzymogenes [TaxId:69] [54809] (3 PDB entries)
  8. 32197Domain d2prob2: 2pro B:86-158 [38823]

Details for d2prob2

PDB Entry: 2pro (more details), 3 Å

PDB Description: pro region of alpha-lytic protease

SCOP Domain Sequences for d2prob2:

Sequence, based on SEQRES records: (download)

>d2prob2 d.52.1.1 (B:86-158) Alpha-lytic protease prodomain {Lysobacter enzymogenes}
yslkqlqsameqldaganarvkgvskpldgvqswyvdprsnavvvkvddgatdagvdfva
lsgadsaqvries

Sequence, based on observed residues (ATOM records): (download)

>d2prob2 d.52.1.1 (B:86-158) Alpha-lytic protease prodomain {Lysobacter enzymogenes}
yslkqlqsameqldagagvqswyvdprsnavvvkvddgatdagvdfvalsgadsaqvrie
s

SCOP Domain Coordinates for d2prob2:

Click to download the PDB-style file with coordinates for d2prob2.
(The format of our PDB-style files is described here.)

Timeline for d2prob2: