Lineage for d2prob1 (2pro B:4-85)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503440Fold d.52: Alpha-lytic protease prodomain-like [54805] (7 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 503441Superfamily d.52.1: Alpha-lytic protease prodomain [54806] (1 family) (S)
  5. 503442Family d.52.1.1: Alpha-lytic protease prodomain [54807] (1 protein)
  6. 503443Protein Alpha-lytic protease prodomain [54808] (1 species)
    duplication: consists of two domains of this fold
  7. 503444Species Lysobacter enzymogenes [TaxId:69] [54809] (3 PDB entries)
  8. 503455Domain d2prob1: 2pro B:4-85 [38822]

Details for d2prob1

PDB Entry: 2pro (more details), 3 Å

PDB Description: pro region of alpha-lytic protease

SCOP Domain Sequences for d2prob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2prob1 d.52.1.1 (B:4-85) Alpha-lytic protease prodomain {Lysobacter enzymogenes}
vdpqlkfamqrdlgifptqlpqylqteklartqaaaierefgaqfagswiernedgsfkl
vaatsgarksstlggvevrnvr

SCOP Domain Coordinates for d2prob1:

Click to download the PDB-style file with coordinates for d2prob1.
(The format of our PDB-style files is described here.)

Timeline for d2prob1: