Lineage for d2proa1 (2pro A:5-85)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190902Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 2190903Superfamily d.52.1: Alpha-lytic protease prodomain [54806] (1 family) (S)
    automatically mapped to Pfam PF02983
  5. 2190904Family d.52.1.1: Alpha-lytic protease prodomain [54807] (1 protein)
  6. 2190905Protein Alpha-lytic protease prodomain [54808] (1 species)
    duplication: consists of two domains of this fold
  7. 2190906Species Lysobacter enzymogenes [TaxId:69] [54809] (3 PDB entries)
  8. 2190915Domain d2proa1: 2pro A:5-85 [38820]

Details for d2proa1

PDB Entry: 2pro (more details), 3 Å

PDB Description: pro region of alpha-lytic protease
PDB Compounds: (A:) alpha-lytic protease

SCOPe Domain Sequences for d2proa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2proa1 d.52.1.1 (A:5-85) Alpha-lytic protease prodomain {Lysobacter enzymogenes [TaxId: 69]}
dpqlkfamqrdlgifptqlpqylqteklartqaaaierefgaqfagswiernedgsfklv
aatsgarksstlggvevrnvr

SCOPe Domain Coordinates for d2proa1:

Click to download the PDB-style file with coordinates for d2proa1.
(The format of our PDB-style files is described here.)

Timeline for d2proa1: