Lineage for d2proa1 (2pro A:5-85)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32181Fold d.52: Alpha-lytic protease prodomain-like [54805] (3 superfamilies)
  4. 32182Superfamily d.52.1: Alpha-lytic protease prodomain [54806] (1 family) (S)
  5. 32183Family d.52.1.1: Alpha-lytic protease prodomain [54807] (1 protein)
  6. 32184Protein Alpha-lytic protease prodomain [54808] (1 species)
  7. 32185Species Lysobacter enzymogenes [TaxId:69] [54809] (3 PDB entries)
  8. 32194Domain d2proa1: 2pro A:5-85 [38820]

Details for d2proa1

PDB Entry: 2pro (more details), 3 Å

PDB Description: pro region of alpha-lytic protease

SCOP Domain Sequences for d2proa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2proa1 d.52.1.1 (A:5-85) Alpha-lytic protease prodomain {Lysobacter enzymogenes}
dpqlkfamqrdlgifptqlpqylqteklartqaaaierefgaqfagswiernedgsfklv
aatsgarksstlggvevrnvr

SCOP Domain Coordinates for d2proa1:

Click to download the PDB-style file with coordinates for d2proa1.
(The format of our PDB-style files is described here.)

Timeline for d2proa1: