SCOPe 2.06: Domain d4proc2: 4pro C:86-166

Lineage for d4proc2 (4pro C:86-166)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.1: Alpha-lytic protease prodomain [54806] (1 family)
   automatically mapped to Pfam PF02983

5. Family d.52.1.1: Alpha-lytic protease prodomain [54807] (1 protein)

6. Protein Alpha-lytic protease prodomain [54808] (1 species)
   duplication: consists of two domains of this fold

7. Species Lysobacter enzymogenes [TaxId:69] [54809] (3 PDB entries)

8. Domain d4proc2: 4pro C:86-166 [38817]
   Other proteins in same PDB: d4proa_, d4prob_

Details for d4proc2

PDB Entry: 4pro, 2.4 Å

PDB Description: alpha-lytic protease complexed with pro region

PDB Compounds: (C:) alpha-lytic protease

SCOPe Domain Sequences for d4proc2:

Sequence, based on SEQRES records:

>d4proc2 d.52.1.1 (C:86-166) Alpha-lytic protease prodomain {Lysobacter enzymogenes [TaxId: 69]}
yslkqlqsameqldaganarvkgvskpldgvqswyvdprsnavvvkvddgatdagvdfva
lsgadsaqvriesspgklqtt

Sequence, based on observed residues (ATOM records):

>d4proc2 d.52.1.1 (C:86-166) Alpha-lytic protease prodomain {Lysobacter enzymogenes [TaxId: 69]}
yslkqlqsameqldaganapldgvqswyvdprsnavvvkvddgatdagvdfvalsgadsa
qvriesspgklqtt

Timeline for d4proc2:

• d4proc2 first appeared (with stable ids) in SCOP 1.55
  
• d4proc2 appears in SCOPe 2.05
  
• d4proc2 appears in SCOPe 2.07
  
• d4proc2 appears in the current release, SCOPe 2.08