SCOPe 2.08: Domain d6oq4b_: 6oq4 B:

Lineage for d6oq4b_ (6oq4 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)

8. Domain d6oq4b_: 6oq4 B: [388166]
   automated match to d4hdob_
   complexed with gnp, mg, n0g

Details for d6oq4b_

PDB Entry: 6oq4, 1.75 Å

PDB Description: crystal structure of the ternary complex of krit1 bound to both the rap1 gtpase and hki1

PDB Compounds: (B:) Ras-related protein Rap-1b

SCOPe Domain Sequences for d6oq4b_:

Sequence, based on SEQRES records:

>d6oq4b_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
edervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr

Sequence, based on observed residues (ATOM records):

>d6oq4b_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
teamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdlede
rvvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr

Timeline for d6oq4b_:

• d6oq4b_ first appeared in SCOPe 2.07