SCOP 1.59: Domain d4proc1: 4pro C:6-85

Lineage for d4proc1 (4pro C:6-85)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (3 superfamilies)

4. Superfamily d.52.1: Alpha-lytic protease prodomain [54806] (1 family)

5. Family d.52.1.1: Alpha-lytic protease prodomain [54807] (1 protein)

6. Protein Alpha-lytic protease prodomain [54808] (1 species)

7. Species Lysobacter enzymogenes [TaxId:69] [54809] (3 PDB entries)

8. Domain d4proc1: 4pro C:6-85 [38816]
   Other proteins in same PDB: d4proa_, d4prob_

Details for d4proc1

PDB Entry: 4pro, 2.4 Å

PDB Description: alpha-lytic protease complexed with pro region

SCOP Domain Sequences for d4proc1:

Sequence; same for both SEQRES and ATOM records:

>d4proc1 d.52.1.1 (C:6-85) Alpha-lytic protease prodomain {Lysobacter enzymogenes}
pqlkfamqrdlgifptqlpqylqteklartqaaaierefgaqfagswiernedgsfklva
atsgarksstlggvevrnvr

Timeline for d4proc1:

• d4proc1 first appeared (with stable ids) in SCOP 1.55
  
• d4proc1 appears in SCOP 1.57
  
• d4proc1 appears in SCOP 1.61
  
• d4proc1 appears in the current release, SCOPe 2.08