Lineage for d4proc1 (4pro C:6-85)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79802Fold d.52: Alpha-lytic protease prodomain-like [54805] (3 superfamilies)
  4. 79803Superfamily d.52.1: Alpha-lytic protease prodomain [54806] (1 family) (S)
  5. 79804Family d.52.1.1: Alpha-lytic protease prodomain [54807] (1 protein)
  6. 79805Protein Alpha-lytic protease prodomain [54808] (1 species)
  7. 79806Species Lysobacter enzymogenes [TaxId:69] [54809] (3 PDB entries)
  8. 79811Domain d4proc1: 4pro C:6-85 [38816]
    Other proteins in same PDB: d4proa_, d4prob_

Details for d4proc1

PDB Entry: 4pro (more details), 2.4 Å

PDB Description: alpha-lytic protease complexed with pro region

SCOP Domain Sequences for d4proc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4proc1 d.52.1.1 (C:6-85) Alpha-lytic protease prodomain {Lysobacter enzymogenes}
pqlkfamqrdlgifptqlpqylqteklartqaaaierefgaqfagswiernedgsfklva
atsgarksstlggvevrnvr

SCOP Domain Coordinates for d4proc1:

Click to download the PDB-style file with coordinates for d4proc1.
(The format of our PDB-style files is described here.)

Timeline for d4proc1: