Lineage for d3prod1 (3pro D:3-85)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411467Fold d.52: Alpha-lytic protease prodomain-like [54805] (7 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 411468Superfamily d.52.1: Alpha-lytic protease prodomain [54806] (1 family) (S)
  5. 411469Family d.52.1.1: Alpha-lytic protease prodomain [54807] (1 protein)
  6. 411470Protein Alpha-lytic protease prodomain [54808] (1 species)
    duplication: consists of two domains of this fold
  7. 411471Species Lysobacter enzymogenes [TaxId:69] [54809] (3 PDB entries)
  8. 411474Domain d3prod1: 3pro D:3-85 [38814]
    Other proteins in same PDB: d3proa_, d3prob_

Details for d3prod1

PDB Entry: 3pro (more details), 1.8 Å

PDB Description: alpha-lytic protease complexed with c-terminal truncated pro region

SCOP Domain Sequences for d3prod1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3prod1 d.52.1.1 (D:3-85) Alpha-lytic protease prodomain {Lysobacter enzymogenes}
qvdpqlkfamqrdlgifptqlpqylqteklartqaaaierefgaqfagswiernedgsfk
lvaatsgarksstlggvevrnvr

SCOP Domain Coordinates for d3prod1:

Click to download the PDB-style file with coordinates for d3prod1.
(The format of our PDB-style files is described here.)

Timeline for d3prod1: