Lineage for d3proc2 (3pro C:86-163)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411467Fold d.52: Alpha-lytic protease prodomain-like [54805] (7 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 411468Superfamily d.52.1: Alpha-lytic protease prodomain [54806] (1 family) (S)
  5. 411469Family d.52.1.1: Alpha-lytic protease prodomain [54807] (1 protein)
  6. 411470Protein Alpha-lytic protease prodomain [54808] (1 species)
    duplication: consists of two domains of this fold
  7. 411471Species Lysobacter enzymogenes [TaxId:69] [54809] (3 PDB entries)
  8. 411473Domain d3proc2: 3pro C:86-163 [38813]
    Other proteins in same PDB: d3proa_, d3prob_

Details for d3proc2

PDB Entry: 3pro (more details), 1.8 Å

PDB Description: alpha-lytic protease complexed with c-terminal truncated pro region

SCOP Domain Sequences for d3proc2:

Sequence, based on SEQRES records: (download)

>d3proc2 d.52.1.1 (C:86-163) Alpha-lytic protease prodomain {Lysobacter enzymogenes}
yslkqlqsameqldaganarvkgvskpldgvqswyvdprsnavvvkvddgatdagvdfva
lsgadsaqvriesspgkl

Sequence, based on observed residues (ATOM records): (download)

>d3proc2 d.52.1.1 (C:86-163) Alpha-lytic protease prodomain {Lysobacter enzymogenes}
yslkqlqsameqldaganaldgvqswyvdprsnavvvkvddgatdagvdfvalsgadsaq
vriesspgkl

SCOP Domain Coordinates for d3proc2:

Click to download the PDB-style file with coordinates for d3proc2.
(The format of our PDB-style files is described here.)

Timeline for d3proc2: