Lineage for d3proc2 (3pro C:86-163)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79802Fold d.52: Alpha-lytic protease prodomain-like [54805] (3 superfamilies)
  4. 79803Superfamily d.52.1: Alpha-lytic protease prodomain [54806] (1 family) (S)
  5. 79804Family d.52.1.1: Alpha-lytic protease prodomain [54807] (1 protein)
  6. 79805Protein Alpha-lytic protease prodomain [54808] (1 species)
  7. 79806Species Lysobacter enzymogenes [TaxId:69] [54809] (3 PDB entries)
  8. 79808Domain d3proc2: 3pro C:86-163 [38813]
    Other proteins in same PDB: d3proa_, d3prob_

Details for d3proc2

PDB Entry: 3pro (more details), 1.8 Å

PDB Description: alpha-lytic protease complexed with c-terminal truncated pro region

SCOP Domain Sequences for d3proc2:

Sequence, based on SEQRES records: (download)

>d3proc2 d.52.1.1 (C:86-163) Alpha-lytic protease prodomain {Lysobacter enzymogenes}
yslkqlqsameqldaganarvkgvskpldgvqswyvdprsnavvvkvddgatdagvdfva
lsgadsaqvriesspgkl

Sequence, based on observed residues (ATOM records): (download)

>d3proc2 d.52.1.1 (C:86-163) Alpha-lytic protease prodomain {Lysobacter enzymogenes}
yslkqlqsameqldaganaldgvqswyvdprsnavvvkvddgatdagvdfvalsgadsaq
vriesspgkl

SCOP Domain Coordinates for d3proc2:

Click to download the PDB-style file with coordinates for d3proc2.
(The format of our PDB-style files is described here.)

Timeline for d3proc2: