Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.0: automated matches [191342] (1 protein) not a true family |
Protein automated matches [190230] (23 species) not a true protein |
Species Oryza sativa [TaxId:39947] [388123] (3 PDB entries) |
Domain d6kbeb_: 6kbe B: [388125] Other proteins in same PDB: d6kbeg1, d6kbeg2 automated match to d4dhib_ |
PDB Entry: 6kbe (more details), 2.34 Å
SCOPe Domain Sequences for d6kbeb_:
Sequence, based on SEQRES records: (download)
>d6kbeb_ d.3.1.0 (B:) automated matches {Oryza sativa [TaxId: 39947]} lpyvgdkeplstlaaefqsgspilqekikllgeqydalrrtrgdgncfyrsfmfsylehi letqdkaeverilkkieqckktladlgyieftfedffsifidqlesvlqghessigaeel lertrdqmvsdyvvmffrfvtsgeiqrraeffepfisgltnstvvqfckasvepmgeesd hvhiialsdalgvpirvmyldrsscdagnisvnhhdfspeanssdgaaaaekpyitllyr pghydilypk
>d6kbeb_ d.3.1.0 (B:) automated matches {Oryza sativa [TaxId: 39947]} lpyvgdkeplstlaaefqsgspilqekikllgeqydalrrtrgdgncfyrsfmfsylehi letqdkaeverilkkieqckktladlgyieftfedffsifidqlesvlqghessigaeel lertrdqmvsdyvvmffrfvtsgeiqrraeffepfisgltnstvvqfckasvepmgeesd hvhiialsdalgvpirvmyldrsscdagnisvnhhdfspekpyitllyrpghydilypk
Timeline for d6kbeb_: