Lineage for d6kbeb_ (6kbe B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927640Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2927641Protein automated matches [190230] (23 species)
    not a true protein
  7. 2927789Species Oryza sativa [TaxId:39947] [388123] (3 PDB entries)
  8. 2927795Domain d6kbeb_: 6kbe B: [388125]
    Other proteins in same PDB: d6kbeg1, d6kbeg2
    automated match to d4dhib_

Details for d6kbeb_

PDB Entry: 6kbe (more details), 2.34 Å

PDB Description: structure of deubiquitinase
PDB Compounds: (B:) ubiquitin thioesterase

SCOPe Domain Sequences for d6kbeb_:

Sequence, based on SEQRES records: (download)

>d6kbeb_ d.3.1.0 (B:) automated matches {Oryza sativa [TaxId: 39947]}
lpyvgdkeplstlaaefqsgspilqekikllgeqydalrrtrgdgncfyrsfmfsylehi
letqdkaeverilkkieqckktladlgyieftfedffsifidqlesvlqghessigaeel
lertrdqmvsdyvvmffrfvtsgeiqrraeffepfisgltnstvvqfckasvepmgeesd
hvhiialsdalgvpirvmyldrsscdagnisvnhhdfspeanssdgaaaaekpyitllyr
pghydilypk

Sequence, based on observed residues (ATOM records): (download)

>d6kbeb_ d.3.1.0 (B:) automated matches {Oryza sativa [TaxId: 39947]}
lpyvgdkeplstlaaefqsgspilqekikllgeqydalrrtrgdgncfyrsfmfsylehi
letqdkaeverilkkieqckktladlgyieftfedffsifidqlesvlqghessigaeel
lertrdqmvsdyvvmffrfvtsgeiqrraeffepfisgltnstvvqfckasvepmgeesd
hvhiialsdalgvpirvmyldrsscdagnisvnhhdfspekpyitllyrpghydilypk

SCOPe Domain Coordinates for d6kbeb_:

Click to download the PDB-style file with coordinates for d6kbeb_.
(The format of our PDB-style files is described here.)

Timeline for d6kbeb_: