Lineage for d1e3pa5 (1e3p A:579-634)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554114Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 2554177Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2554178Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 2554190Protein Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 [54803] (1 species)
    the type of KH-domain fold (II or I) adopted by this domain is not ascertained yet
  7. 2554191Species Streptomyces antibioticus [TaxId:1890] [54804] (2 PDB entries)
  8. 2554192Domain d1e3pa5: 1e3p A:579-634 [38811]
    Other proteins in same PDB: d1e3pa1, d1e3pa2, d1e3pa3, d1e3pa4, d1e3pa6, d1e3pa7
    partly disordered
    complexed with so4, wo4

Details for d1e3pa5

PDB Entry: 1e3p (more details), 2.5 Å

PDB Description: tungstate derivative of streptomyces antibioticus pnpase/gpsi enzyme
PDB Compounds: (A:) guanosine pentaphosphate synthetase

SCOPe Domain Sequences for d1e3pa5:

Sequence, based on SEQRES records: (download)

>d1e3pa5 d.52.3.1 (A:579-634) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]}
apriitvkipvdkigevigpkrqminqiqedtgaeitieddgtiyigaadgpaaea

Sequence, based on observed residues (ATOM records): (download)

>d1e3pa5 d.52.3.1 (A:579-634) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]}
apriitvnqiqedtgaeiyigaadgpaaea

SCOPe Domain Coordinates for d1e3pa5:

Click to download the PDB-style file with coordinates for d1e3pa5.
(The format of our PDB-style files is described here.)

Timeline for d1e3pa5: