SCOPe 2.08: Domain d6vqoh2: 6vqo H:116-200

Lineage for d6vqoh2 (6vqo H:116-200)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6vqoh2: 6vqo H:116-200 [388101]
   Other proteins in same PDB: d6vqoa1, d6vqoa2, d6vqob1, d6vqob2, d6vqod1, d6vqoe1, d6vqoe2, d6vqof1, d6vqof2, d6vqog1, d6vqog2, d6vqoh1, d6vqoj1, d6vqoj2
   automated match to d2f54d2

Details for d6vqoh2

PDB Entry: 6vqo, 3 Å

PDB Description: t cell receptor-p53-hla-a2 complex

PDB Compounds: (H:) T-cell receptor 1a2, alfa chain

SCOPe Domain Sequences for d6vqoh2:

Sequence, based on SEQRES records:

>d6vqoh2 b.1.1.2 (H:116-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedt

Sequence, based on observed residues (ATOM records):

>d6vqoh2 b.1.1.2 (H:116-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdsksksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsav
awsnksdfacanafnnsiipedt

Timeline for d6vqoh2:

• d6vqoh2 first appeared in SCOPe 2.07