Lineage for d1e3ha4 (1e3h A:579-632)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554114Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 2554177Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2554178Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 2554190Protein Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 [54803] (1 species)
    the type of KH-domain fold (II or I) adopted by this domain is not ascertained yet
  7. 2554191Species Streptomyces antibioticus [TaxId:1890] [54804] (2 PDB entries)
  8. 2554193Domain d1e3ha4: 1e3h A:579-632 [38810]
    Other proteins in same PDB: d1e3ha1, d1e3ha2, d1e3ha3, d1e3ha5, d1e3ha6
    partly disordered
    complexed with so4

Details for d1e3ha4

PDB Entry: 1e3h (more details), 2.6 Å

PDB Description: semet derivative of streptomyces antibioticus pnpase/gpsi enzyme
PDB Compounds: (A:) guanosine pentaphosphate synthetase

SCOPe Domain Sequences for d1e3ha4:

Sequence, based on SEQRES records: (download)

>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]}
apriitvkipvdkigevigpkrqminqiqedtgaeitieddgtiyigaadgpaa

Sequence, based on observed residues (ATOM records): (download)

>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]}
apriiqiqedtgaeiyigaadgpaa

SCOPe Domain Coordinates for d1e3ha4:

Click to download the PDB-style file with coordinates for d1e3ha4.
(The format of our PDB-style files is described here.)

Timeline for d1e3ha4: