Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins) |
Protein Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 [54803] (1 species) the type of KH-domain fold (II or I) adopted by this domain is not ascertained yet |
Species Streptomyces antibioticus [TaxId:1890] [54804] (2 PDB entries) |
Domain d1e3ha4: 1e3h A:579-632 [38810] Other proteins in same PDB: d1e3ha1, d1e3ha2, d1e3ha3, d1e3ha5, d1e3ha6 partly disordered complexed with so4 |
PDB Entry: 1e3h (more details), 2.6 Å
SCOPe Domain Sequences for d1e3ha4:
Sequence, based on SEQRES records: (download)
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} apriitvkipvdkigevigpkrqminqiqedtgaeitieddgtiyigaadgpaa
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} apriiqiqedtgaeiyigaadgpaa
Timeline for d1e3ha4: