Lineage for d1vih__ (1vih -)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602675Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 602676Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 602677Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (9 proteins)
    an RNA-binding domain
  6. 602710Protein Vigilin, KH6 [54797] (1 species)
  7. 602711Species Human (Homo sapiens) [TaxId:9606] [54798] (2 PDB entries)
  8. 602713Domain d1vih__: 1vih - [38807]

Details for d1vih__

PDB Entry: 1vih (more details)

PDB Description: nmr study of vigilin, repeat 6, minimized average structure

SCOP Domain Sequences for d1vih__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vih__ d.51.1.1 (-) Vigilin, KH6 {Human (Homo sapiens)}
inrmdyveinidhkfhrhligksganinrikdqykvsvrippdseksnliriegdpqgvq
qakrellelas

SCOP Domain Coordinates for d1vih__:

Click to download the PDB-style file with coordinates for d1vih__.
(The format of our PDB-style files is described here.)

Timeline for d1vih__: