Lineage for d6xaaa2 (6xaa A:62-313)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2497139Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2497140Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2498013Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
    C-terminal part of Pfam PF08715
  6. 2498033Protein automated matches [310868] (6 species)
    not a true protein
  7. 3085163Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [385225] (21 PDB entries)
  8. 3087986Domain d6xaaa2: 6xaa A:62-313 [388048]
    Other proteins in same PDB: d6xaaa1, d6xaab_
    automated match to d2fe8a2
    complexed with zn

Details for d6xaaa2

PDB Entry: 6xaa (more details), 2.7 Å

PDB Description: sars cov-2 plpro in complex with ubiquitin propargylamide
PDB Compounds: (A:) papain-like protease

SCOPe Domain Sequences for d6xaaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xaaa2 d.3.1.23 (A:62-313) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
dtlrveafeyyhttdpsflgrymsalnhtkkwkypqvngltsikwadnncylatalltlq
qielkfnppalqdayyrarageaanfcalilaycnktvgelgdvretmsylfqhanldsc
krvlnvvcktcgqqqttlkgveavmymgtlsyeqfkkgvqipctcgkqatkylvqqespf
vmmsappaqyelkhgtftcaseytgnyqcghykhitsketlycidgalltksseykgpit
dvfykensyttt

SCOPe Domain Coordinates for d6xaaa2:

Click to download the PDB-style file with coordinates for d6xaaa2.
(The format of our PDB-style files is described here.)

Timeline for d6xaaa2:

  • d6xaaa2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6xaaa1
View in 3D
Domains from other chains:
(mouse over for more information)
d6xaab_